PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005818
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family BBR-BPC
Protein Properties Length: 278aa    MW: 31097.7 Da    PI: 10.5765
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005818genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind315.71.5e-9612781301
  GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllalllv 87 
                md d+ + rn+gyyep+  lk +lglqlms+i e+d k     r++  a+ + +aa+++r+          ++  rd ++++       +++kl+++l+ 
  Cla005818   1 MDGDALNMRNWGYYEPS--LKAHLGLQLMSTIGEQDVKHflpgRDAS-AIVNMNAAFHSREsvvsdasvpTSW-GRDGWINH-------HRDKLFNMLTP 89 
                99999988*******99..*******************999966555.599**********777777665555.67777776.......77899999997 PP

  GAGA_bind  88 enslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaders 187
                ++s        ++ l +t+  + lq+     l+++ +   + e   +l+iee ++++k +k++kkrq++  pk++k kk++k       k++ +s+ +r+
  Cla005818  90 TTS--------YSLLAETSGPQPLQM-----LQPHNTS--RDE--MVLKIEE-PPVKKGTKQPKKRQNGGAPKTPKPKKPRK------PKNNDPSV-QRV 164
                776........889999999999999.....5555444..223..3355544.7888999999*****************99......23344554.699 PP

  GAGA_bind 188 kaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkd 287
                ka+kk+++lv+ng ++D+s++P+PvCsCtG+++qCY+WG GGWqSaCCtt++S +PLP+s krrgaRiagrKmSqgafkk+LekLaa+Gy++snp+DL++
  Cla005818 165 KAPKKKMELVINGFDMDISSIPIPVCSCTGTPHQCYRWGYGGWQSACCTTSLSLHPLPMSEKRRGARIAGRKMSQGAFKKVLEKLAAQGYNFSNPIDLRS 264
                **************************************************************************************************** PP

  GAGA_bind 288 hWAkHGtnkfvtir 301
                hWA+HGtnkfvtir
  Cla005818 265 HWARHGTNKFVTIR 278
                *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.2E-1481278IPR010409GAGA-binding transcriptional activator
PfamPF062173.7E-1022278IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MDGDALNMRN WGYYEPSLKA HLGLQLMSTI GEQDVKHFLP GRDASAIVNM NAAFHSRESV  60
VSDASVPTSW GRDGWINHHR DKLFNMLTPT TSYSLLAETS GPQPLQMLQP HNTSRDEMVL  120
KIEEPPVKKG TKQPKKRQNG GAPKTPKPKK PRKPKNNDPS VQRVKAPKKK MELVINGFDM  180
DISSIPIPVC SCTGTPHQCY RWGYGGWQSA CCTTSLSLHP LPMSEKRRGA RIAGRKMSQG  240
AFKKVLEKLA AQGYNFSNPI DLRSHWARHG TNKFVTIR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150151.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD02e-98BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A0A0KLI80.0A0A0A0KLI8_CUCSA; Uncharacterized protein
STRINGGLYMA05G26790.21e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-95basic pentacysteine 2